Mature structures

Not much is known about the mechanisms that ensure efficient discrimination between ER proteins, which are in the process of folding and will finally form stable enzymes, and those, which fail to acquire their mature structure and have to be degraded. For example, small peptide stretches, which are buried in the mature but exposed in a native conformation of a protein, have... 

Fig. 9. (a) Overlay of the combining site for AZ-28 affinity-matured structures, with... 

The manifestations of toxicant exposure during fetal development are most often characterized as retarded growth or a lack of functional maturation. Structural malformations that do result from fetal exposure to a toxicant are more often attributed to toxicant-induced deformation of a once-normal structure. The central nervous system is a prime target during this period, and fetal exposure to developmental toxicants can lead to mental retardation as well as deficits in behavioral, mental, and motor skills. 

HIV protease HIV infection, AIDS Cleavage of gag and gag-pol precursor polyproteins into mature, structural and functional viral proteins Inhibition at active site... 

Figure 2 The structure of the absorptive cell of the intestinal lining reflects its specialized function in digestion. The absorptive cell is one of the two main cell types that constitute the epithelium of the villus. The other type is the goblet cell, which secretes mucus. Cells of both types are produced by cell division in the crypts and assume their mature structure during a 2-day migration to the villus tip. Exposed in transit to the action of digestive fluids, some of the membrane covering the absorptive cell may be sloughed off. The cell is abundantly supplied with mitochondria, which provide energy for metabolic...

Sundberg EJ, Andersen PS, Schlievert PM, Kaijalainen K, Mariuzza RA Structural, energetic, and functional analysis of a protein-protein interface at distinct stages of affinity maturation. Structure 2003 11 1151-1161. 

The amino acid sequence derived from the DNA sequence is that of the nascent polypeptide chain before any posttranslational modifications. Since the function of a protein depends on its mature structure, it is often necessary to analyze the protein itself to determine if any changes have occurred after translation. 

The traditional approach to yield curve fitting involves the calculation of a set of discount factors from market interest rates. From this, a spot yield curve can be estimated. The market data can be money market interest rates, futures and swap rates and bond yields. In general, though this approach tends to produce ragged spot rates and a forward rate curve with pronounced jagged knot points, due to the scarcity of data along the maturity structure. A refinement of this technique is to use polynomial approximation to the yield curve. 

Credit-linked notes are hybrid securities, generally issued by an investment-grade entity, that combine a credit derivative with a vanilla bond. Like a vanilla bond, a standard CLN has a fixed maturity structure and pays regular coupons. Unlike bonds, all CLNs, standard or not, link then-returns to an underlying asset s credit-related performance, as well as to the performance of the issuing entity. The issuer, for instance, is usually permitted to decrease the principal amount if a credit event occurs. Say a credit card issuer wants to fond its credit card loan portfolio by issuing debt. To reduce its credit risk, it floats a 2-year credit-linked note. The note has a face value of 100 and pays a coupon of 7.50 percent, which is 200 basis points above the 2-year benchmark. If more than 10 percent of its cardholders are delinquent in making payments, however, the note s redemption payment will be reduced to 85 for every 100 of face value. The credit card issuer has in effect purchased a credit option that lowers its liability should it suffer a specified credit event—in this case, an above-expected incidence of bad debts. 

Nisin HSTKDFNLDLVSVSKKDSGASPR Leader region) ITSISLCTPGCKTGALMGCNHKTATCHCSIHVSK (Niji-M Mature structure region) No No Not applicable 123,125... 

Subtilin (SL -Sub - ) MSKFDDFDLDWKVSKQDSKITPQ (SlI-J4 Leader region) WKSESLCTPGCVTGALQTCFLQTLTCNCKISK (Sub -J Mature structural region) Yes Yes Yes 126... 

SL - -NisS-i>-Nis - ) HSKFDDF LDLVSVSKKDSGASPR (S -Nis - Leader regiott) ITSISLCTPGCKTGALMGCMMKTATCHCSIHVSK Mature structural region) Yes Yes Yes 123... 

SLl-J1-Nis -"-SublJ-M) hskfdofdldwkvskqdski tpq Leader region) ITSISLCTPGC VTGALQTCFDQTI.TCNCKISK (Nis "-Sub W Mature structural regkm) Yes Yes Yes 124... 

Sj i-J4-Sub -"-Nistl-M) MSKFDDFDLDWKVSKQDSKITPQ Leader region) WKSESLCTPGC KTGALMGCNMKTATCHCSIHVSK Sub "il-Nisl " 4 Mature structural region) Heterogeneous Yes Partially 124... 

Mulder DW, Shepard EM, Meuser JE, Joshi N, King PW, Posewitz MC, Broderick JB, Peters JW. Insights into [FeFe]-hydrogenase structure, mechanism, and maturation. Structure 2011 19 1038-1052. 

The result of a lack of polyprenol reductase activity is that glycosylation of N-linked proteins is altered. Both non-glycosylation of certain sites and altered mature structures on certain sites of A -linked glycoproteins are observed in these mutants... 

---