Big Chemical Encyclopedia

Chemical substances, components, reactions, process design ...

Articles Figures Tables About

Giardia intestinalis

Giardia intestinalis contains PFOR and has been shown to produce hydrogen (Lloyd et al. 2002) but has not been found to contain hydrogeno-somes. Its iron-sulfur composition appears to be quite distinct from those of the trichomonads. EPR showed both soluble and membrane-bound iron-sulfur proteins of the [4Fe-4S] type (ElUs et al. 1993). [Pg.118]

Tachezy J, Sanchez LB, Muller M. 2001. Mitochondrial type iron-sulfur cluster assembly in the amitochondriate eukaryotes Trichomonas vaginalis and Giardia intestinalis, as indicated by the phylogeny of IscS. Mol Biol Evo 18 1919-28. [Pg.126]

DnaK/Hsp70 Giardia intestinalis MFLSTLAKKSTTFGVSNVVKNALSSKVMRTTPRMFQRF ESSK van der Giezen et al. (2003)... [Pg.38]

Fig. 2 Mitosomes of Giardia intestinalis localized between axonemes (a) of caudal flagella close to basal bodies (w, nucleus). Scale bar = 500 nm. Kindly provided by E. Noh)mkova, Charles University in Prague, Czech Republic... Fig. 2 Mitosomes of Giardia intestinalis localized between axonemes (a) of caudal flagella close to basal bodies (w, nucleus). Scale bar = 500 nm. Kindly provided by E. Noh)mkova, Charles University in Prague, Czech Republic...
Fig. 4 Immunofluorescence microscopy of Giardia intestinalis showing segregation of mi-tosomes during mitosis. A Interphase, prophase, and C telophase cells. Nuclei were stained by DAPI (blue), mitosomes were detected by an antibody raised against GiiscU (red), and axonemes were visualized by the antibody AXO 49 recognizing polyglycylated carboxy-terminal peptides of a- and fl-tubulin (green). Note the proximity of mitosomes (white arrows) to axonemes... Fig. 4 Immunofluorescence microscopy of Giardia intestinalis showing segregation of mi-tosomes during mitosis. A Interphase, prophase, and C telophase cells. Nuclei were stained by DAPI (blue), mitosomes were detected by an antibody raised against GiiscU (red), and axonemes were visualized by the antibody AXO 49 recognizing polyglycylated carboxy-terminal peptides of a- and fl-tubulin (green). Note the proximity of mitosomes (white arrows) to axonemes...
Arisue N, Sdnchez LB, Weiss LM, Muller M, Hashimoto T (2002) Mitochondrial-type Hsp70 genes of the amitochondriate protists, Giardia intestinalis, Entamoeba histolytica and two microsporidians. Parasitol Int 51 9-16 Balk J, Aguilar Netz DJ, Tepper K, Pierik AJ, Lill R (2005a) The essential WD40 protein Cial is involved in a late step of cytosolic and nuclear iron-sulfur protein assembly. Mol Cell Biol 25 10833-10841... [Pg.225]

Marti M, Regos A, Li Y, Schraner EM, Wild P, Muller N, Knopf LG, Hehl AB (2003) An ancestral secretory apparatus in the protozoan parasite Giardia intestinalis. J Biol Chem 278 24837-24848... [Pg.263]

Excavata Metamonada Giardia intestinalis EM, protein localisation, biochemistry — See Tachezy, this volume... [Pg.268]

Trichomonas vaginalis Giardia intestinalis Entamoeba histolytica Cryptosporidium parvum Encephalitozoon cuniculi... [Pg.111]

Arisue N, Sdchez LB, Weiss LM, Muller M, Hashimoto T (2002) Mitochondrial-type hsp70 genes of the amitochondriate protists, Giardia intestinalis, Entamoeba histolytica and two microsporidians. Parasitol Int 51 9-16... [Pg.127]

Lloyd D, Ralphs JR Harris JC (2002) Giardia intestinalis, a eukaryote without hydrogenosomes, produces hydrogen. Microbiology 148 727-733... [Pg.130]

Tachezy J, Sdnchez LB, Muller M (2001) Mitochondrial type iron-sulfur cluster assembly in the amitochondriate eukaryotes Trichomonas vaginalis and Giardia intestinalis, as indicated by the phylogeny of IscS. Mol Biol Evol 18 1919-1928 Takahashi Y, Tokumoto U (2002) A third bacterial system for the assembly of iron-sulfur clusters with homologs in archaea and plastids. J Biol Chem 277 28380-28383 Thong KW, Coombs GH (1987) Comparative study of ferredoxin-linked and oxygen-metabolizing enzymes of trichomonads. Comp Biochem Physiol B 87 637-641 Tielens AGM, Rotte C, van Hellemond JJ, Martin W (2002) Mitochondria as we don t know them. Trends Biochem Sci 27 564-572... [Pg.132]

Vanacova S, Liston DR, Tachezy J, Johnson PJ (2003) Molecular biology of the amitochondriate parasites, Giardia intestinalis, Entamoeba histolytica and Trichomonas vaginalis. Int J Parasitol 33 235-255... [Pg.158]

Diplomonads K ) M Giardia intestinalis IscS, IscU, Cpn60, mHsp70, Fd, MPP, Pam 18 PFO, hydrogenase No... [Pg.246]

Hehl AB, Marti M (2004) Secretory protein trafficking in Giardia intestinalis. Mol Microbiol 53 19-28... [Pg.297]

Lloyd D, Harris JC, Maroulis S, Wadley R, Ralphs JR, Hann AC, Turner MP, Edwards MR (2002a) The primitive microaerophile Giardia intestinalis (syn. lamblia, duodenalis) has... [Pg.297]

See other pages where Giardia intestinalis is mentioned: [Pg.113]    [Pg.62]    [Pg.72]    [Pg.122]    [Pg.178]    [Pg.201]    [Pg.203]    [Pg.204]    [Pg.217]    [Pg.227]    [Pg.228]    [Pg.229]    [Pg.236]    [Pg.240]    [Pg.240]    [Pg.264]    [Pg.273]    [Pg.274]    [Pg.280]    [Pg.109]    [Pg.117]    [Pg.120]    [Pg.244]    [Pg.252]    [Pg.252]    [Pg.274]    [Pg.279]    [Pg.280]    [Pg.295]    [Pg.298]   
See also in sourсe #XX -- [ Pg.113 , Pg.114 , Pg.118 ]

See also in sourсe #XX -- [ Pg.10 , Pg.23 , Pg.31 , Pg.35 , Pg.43 , Pg.54 , Pg.57 , Pg.122 , Pg.132 , Pg.204 , Pg.212 , Pg.213 , Pg.217 , Pg.256 ]

See also in sourсe #XX -- [ Pg.26 , Pg.1063 ]

See also in sourсe #XX -- [ Pg.1063 ]

See also in sourсe #XX -- [ Pg.681 ]

See also in sourсe #XX -- [ Pg.504 ]

See also in sourсe #XX -- [ Pg.76 , Pg.124 ]

See also in sourсe #XX -- [ Pg.652 ]



SEARCH



Giardia

Giardia lamblia (intestinalis

© 2024 chempedia.info