Plasmid deoxyribonucleic acid

Deoxyribonucleic acid (from plasmids). Purified by two buoyant density ultracentrifugations using ethidium bromide-CsCl. The ethidium bromide was extracted with Et20 and the DNA was dialysed against buffered EDTA and lyophilised. [Marmur and Doty J Mol Biol 5 109 1962 Guerry et al. J Bacteriol II6 1064 1973.] See p. 504. 

Kempler, G. M. and McKay, L. L. 1979. Characterization of plasmid deoxyribonucleic acid in Streptococcus lactis subsp. diacetylactis Evidence for plamid-linked citrate utilization. Appl. Environ. Microbiol 37, 316-323. 

Anti-deoxyribonucleic acid autoantibodies from human and mice suffering from Lupus erythematosus can penetrate into cells and accumulate in the cell nucleus. Based on the characteristics of a mi-ON A autoantibodies, VAYISRGGVSTYYSDTVKGRFTRQKYNKRA peptide (P3), which exhibits a-helix, has been used as a vector for the intracytoplasmic and intranuclear translocation of macromolecules (Table 16.7) (Avrameas et al., 1998, 1999). P3 shares similar capabilities with Antenapedia peptide (Derossi et al., 1994), but in contrast P3 operates only at 37 °C by an energy dependent mechanism. P3 linked to a 19 lysine residue sequence (K19-P3) forms complexes with plasmid DNA. Efficient transfection of mouse 3T3 cells and hamster lung CCL39 cells were obtained with these complexes. This transfection was not impaired by the presence of serum and did not require helper molecules such as chloroquine. These observations suggest that peptides from cell specific anti-DNA autoantibodies may represent a source of peptide-based gene delivery system with different specificities. 

Fortuin FD, Vale P Losordo DW, et al, One-year follow-up of direct myocardial gene transfer of vascular endothelial growth factor-2 using naked plasmid deoxyribonucleic acid by way of thoracotomy in no-option patients. Am J Cardiol 2003 92(4) 43 6-43 9. 

Flavonoids, due to their ability to absorb ultraviolet (UV) radiation, can protect DNA (Deoxyribonucleic acid) from the damage caused by UV radiation. This effect is one of the physiological functions proposed for the flavonoids in plants [57], In studies performed with UV-B irradiated plasmids, both naringenin and rutin showed protecting activity against DNA damage, induced by UV radiation [58], Besides a direct protection,... 

Deoxyribonucleic acid (from plasmids). These are purified by two buoyant density ultracentrifugations... 

Tanaka, T. and Weisbium, R, Construction of a coli in El-R factor composite plasmid in vifa-o means for amplification of deoxyribonucleic acid,5t 7fer/o/., 121,354, 1975. 

Bacterial chromosomes, episomes or plasmids, viruses, DNA molecules of chloroplasts and mitochondria are R. Eukaryotic chromosomes consist of a large number of R., i.e. one DNA molecule has several replication sites. See Deoxyribonucleic acid. 

Fortuin, F. D., Vale, E, bosordo, D. W., Symes, J., Delaria, G. A., Tyner, J. J., Schaer, G. b., March, R., Snell, R. J., Henry, T. D., Van Camp, J., bopez, J. J., Richenbacher, W., Isner, J. M., and Schatz, R. A. 2003. One-year follow-up of direct myocardial gene transfer of vascular endothelial growth factor-2 using naked plasmid deoxyribonucleic acid by way of thoracotomy in no-option patients. American Journal of Cardiology, 92,436-439. 

---