Gene delivery systems peptide-based

Wilke, M., Fortunati, E., Van den Broek, M., Hoogeveen, AT. and Scholte, B.J. (1996) Efficacy of a peptide-based gene delivery system depends on mitotic activity. Gene Ther., 3, 1133-1142. 

The objective of this chapter is to present an overview of peptide-based gene delivery systems. Some excellent reviews have been written recently on this topic, so we shall only do a summary of fusogenic peptides and then we wih present our recent data. We will particularly focus on the recent progress made concerning low molecular peptide-based gene delivery systems. We wih also attempt to make readers aware of the conceptual and experimental aspects of peptide-based gene delivery system design. 

Table 16.6 Peptide-based gene delivery systems with selectivity...

DNA binding moiety has been synthesized and evaluated as a receptor-mediated gene delivery system. The system was able to transfect about 30% of corneal endothelial cells of rabbit, pig and human in the presence of chloroquine (Shewring et al., 1997). Associated with the fusogenic peptide of influenza, this peptide transfected 25-30% of primary cultures of vascular smooth muscle cells of man, rabbit and rat (Collins et al., 2000 Li et al., 2000). The molossin-based gene delivery system represents an interesting system in transplantation because the molossin peptide does not bind to vascular endothelium and pancreatic islets. 

The assembly of NLS in peptide-based gene delivery systems has been achieved by the non-covalent binding of plasmid to either free NLS embedded with polyplexes or to NLS linked to a cationic sequence, such as (PKKKRKV)4-K2o (Table 16.7), AKRARLSTSFNPVYPYEDES-K20 (Table 16.7) or H9-2 sequence (nls-H9-2) (Table 16.4). With nls-H9-2, the transfection efficiency with a formulation containing... 

Anti-deoxyribonucleic acid autoantibodies from human and mice suffering from Lupus erythematosus can penetrate into cells and accumulate in the cell nucleus. Based on the characteristics of a mi-ON A autoantibodies, VAYISRGGVSTYYSDTVKGRFTRQKYNKRA peptide (P3), which exhibits a-helix, has been used as a vector for the intracytoplasmic and intranuclear translocation of macromolecules (Table 16.7) (Avrameas et al., 1998, 1999). P3 shares similar capabilities with Antenapedia peptide (Derossi et al., 1994), but in contrast P3 operates only at 37 °C by an energy dependent mechanism. P3 linked to a 19 lysine residue sequence (K19-P3) forms complexes with plasmid DNA. Efficient transfection of mouse 3T3 cells and hamster lung CCL39 cells were obtained with these complexes. This transfection was not impaired by the presence of serum and did not require helper molecules such as chloroquine. These observations suggest that peptides from cell specific anti-DNA autoantibodies may represent a source of peptide-based gene delivery system with different specificities. 

Peptide-based gene delivery systems PATRICK MIDOUX AND CHANTAL PICHON... 

Synthetic peptide-based gene delivery systems consisting of a lysine-rich DNA binding motif and endosomolytic motif have been developed for in vivo gene delivery. One example of such a gene delivery system comprises ... 

---