Big Chemical Encyclopedia

Chemical substances, components, reactions, process design ...

Articles Figures Tables About

Transmembrane sequences, fragments

GYLEKYDEYFNSLNNVFLDFKSSLVGTGTSNNEGLLDRVLQVLMTVKNSE Figure 1. N-Terminal sequence of a-LTX. Possible transmembrane toxin fragments are underlined. [Pg.233]

A relatively small minority of APP molecules enter the p-secretase pathway in which p-secretase cleaves APP and releases a soluble fragment, sAPPp. The C-terminal membrane-bound C99 peptide is then cleaved by y-secretase within the transmembrane domain, and two major isoforms of 40 and 42 amino acid lengths with different C-termini, Ap40 and Ap42, are generated. Based on the amino acid sequence, p-secretase is predicted to be a type I transmembrane protein with the active site on the lumenal side of... [Pg.59]

The yeast signal trap This approach anchored Genentech s SPDI program designed to identify secreted and transmembrane proteins. The method involves screening for sequences from a cDNA library that directed the secretion of a reporter protein from yeast [36]. Libraries of cDNA fragments were cloned upstream of a reporter gene, and inserts from yeast colonies secret-... [Pg.124]

See other pages where Transmembrane sequences, fragments is mentioned: [Pg.156]    [Pg.885]    [Pg.289]    [Pg.312]    [Pg.30]    [Pg.191]    [Pg.189]    [Pg.578]    [Pg.195]    [Pg.520]    [Pg.191]    [Pg.571]    [Pg.72]    [Pg.94]    [Pg.355]    [Pg.288]    [Pg.312]    [Pg.138]    [Pg.340]    [Pg.349]    [Pg.632]    [Pg.632]    [Pg.244]    [Pg.275]    [Pg.643]    [Pg.88]    [Pg.7]    [Pg.96]    [Pg.128]    [Pg.107]    [Pg.58]    [Pg.86]    [Pg.39]    [Pg.288]    [Pg.25]    [Pg.34]    [Pg.314]    [Pg.260]    [Pg.254]    [Pg.38]    [Pg.488]    [Pg.2157]    [Pg.34]    [Pg.86]    [Pg.4]    [Pg.399]    [Pg.335]   
See also in sourсe #XX -- [ Pg.290 ]



SEARCH



Transmembrane

Transmembrane sequence

© 2024 chempedia.info