Big Chemical Encyclopedia

Chemical substances, components, reactions, process design ...

Articles Figures Tables About

Chemoattractant Receptor-Homologous

Gervais FG, Sawyer N, Stocco R, Hamel M, Krawczyk C, Sillaots S, et al. Pharmacological characterization of MK-7246, a potent and selective CRTH2 (chemoattractant receptor-homologous molecule expressed on T-Helper Type 2 Cells) Antagonist. Mol. Pharmacol. 2011 79 69-76. [Pg.142]

Fig. 2. RP-HPLC chromatograms of human B cell chemoattractant-1 (BCA-1) (11), an 87 residue chemokine that is the ligand for CXCR5, which is the human homolog of the mouse receptor BLR-1. Its sequence is VLEVYYTSLRCRCVQESSVFIPRR FIDRIQILPRGNGCPRKEIIVWKKNKSIVCVDPQAEWIQRMMEVLR KRSSSTLPVPVFK (11). The BCA-1 polypeptide was synthesized starting with Lys-Pam resin and adding the appropriate protected amino acids until the N-terminal valine was added. The profile of the crude product (A) reveals a major broad peak that consists of the correct polypeptide and numerous closely related and closely eluting... Fig. 2. RP-HPLC chromatograms of human B cell chemoattractant-1 (BCA-1) (11), an 87 residue chemokine that is the ligand for CXCR5, which is the human homolog of the mouse receptor BLR-1. Its sequence is VLEVYYTSLRCRCVQESSVFIPRR FIDRIQILPRGNGCPRKEIIVWKKNKSIVCVDPQAEWIQRMMEVLR KRSSSTLPVPVFK (11). The BCA-1 polypeptide was synthesized starting with Lys-Pam resin and adding the appropriate protected amino acids until the N-terminal valine was added. The profile of the crude product (A) reveals a major broad peak that consists of the correct polypeptide and numerous closely related and closely eluting...
See other pages where Chemoattractant Receptor-Homologous is mentioned: [Pg.193]    [Pg.192]    [Pg.627]    [Pg.404]    [Pg.136]    [Pg.772]    [Pg.772]    [Pg.64]    [Pg.212]    [Pg.960]    [Pg.193]    [Pg.192]    [Pg.627]    [Pg.404]    [Pg.136]    [Pg.772]    [Pg.772]    [Pg.64]    [Pg.212]    [Pg.960]    [Pg.371]    [Pg.90]    [Pg.19]    [Pg.291]    [Pg.1001]    [Pg.160]    [Pg.398]    [Pg.413]    [Pg.1001]    [Pg.190]    [Pg.128]    [Pg.398]    [Pg.413]    [Pg.340]    [Pg.340]    [Pg.252]    [Pg.25]    [Pg.24]   


SEARCH



CRTH2, Chemoattractant Receptor-Homologous Molecule

Chemoattractant

Chemoattractant Receptor-Homologous Molecule Expressed on T Helper Type

Chemoattractant receptor

Chemoattractant receptor receptors

Chemoattractants

Chemoattraction

Homologous receptors

© 2024 chempedia.info